PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009147047.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family CO-like
Protein Properties Length: 386aa    MW: 42423.4 Da    PI: 5.8476
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009147047.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box19.71.7e-06444539
        zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htv 39
                    +C+ ++e++   +C+++  +lC +C  + H+       H++
  XP_009147047.1  4 MCDFCGEQRSMVYCRSDAACLCLSCDRSVHSAnalskrHSR 44
                    6*****************************65677777765 PP

2CCT62.41.4e-21329372144
             CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                     R++a++RYkeK+k RkF+K++rY+sRKa+A+ R RvKGrFvk+ 
  XP_009147047.1 329 RNNAVMRYKEKKKARKFDKTVRYASRKARADVRRRVKGRFVKAG 372
                     99***************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.798147IPR000315B-box-type zinc finger
CDDcd000219.51E-8447No hitNo description
SMARTSM003361.1E-8447IPR000315B-box-type zinc finger
PROSITE profilePS501198.9584377IPR000315B-box-type zinc finger
CDDcd000210.001174773No hitNo description
PfamPF062032.6E-16329371IPR010402CCT domain
PROSITE profilePS5101715.18329371IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 386 aa     Download sequence    Send to blast
MGYMCDFCGE QRSMVYCRSD AACLCLSCDR SVHSANALSK RHSRTLVCER CNSQPATVRC  60
VEERVSLCQN CDWSSHNNNN NSSSSCKNCD WFSHNNNNNS SSSSNNHKRQ TISCYSGCPS  120
SSELASIWSF CLDLAGQSGC EQEMGLMNID DDGQNNQNCN EEKKDVAGSS SRPETSSAAP  180
ATSSFPKDVR VCEDDFYGNL GMDEVDLALE NYEELFGTAF NTSGELFGQG GIDSLFQKHH  240
QAAAPEGGNL VQPAESNDDS FMSSKTEPII CFTSKPAHSN ISFSGVTGDS SAGDFQECGA  300
SSSMQLSGEP PWYPQTSQDN NASSHSVTRN NAVMRYKEKK KARKFDKTVR YASRKARADV  360
RRRVKGRFVK AGEAYDYDPL TPTRSY
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bra.319410.0leaf| silique
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009147047.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 9
RefseqXP_009147048.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 9
SwissprotQ9SSE50.0COL9_ARATH; Zinc finger protein CONSTANS-LIKE 9
TrEMBLM4ELJ80.0M4ELJ8_BRARP; Uncharacterized protein
STRINGBra029666.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16822786
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G07650.40.0CONSTANS-like 9